Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 132 (GPR132), partial

Product Specifications

Product Name Alternative

(G2 accumulation protein)

Abbreviation

Recombinant Human GPR132 protein, partial

Gene Name

GPR132

UniProt

Q9UNW8

Expression Region

311-380aa

Organism

Homo sapiens (Human)

Target Sequence

ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May be a receptor for oxidized free fatty acids derived from linoleic and arachidonic acids such as 9-hydroxyoctadecadienoic acid (9-HODE) . Activates a G alpha protein, most likely G alpha (q) . May be involved in apoptosis. Functions at the G2/M checkpoint to delay mitosis. May function as a sensor that monitors the oxidative states and mediates appropriate cellular responses such as secretion of paracrine signals and attenuation of proliferation. May mediate ths accumulation of intracellular inositol phosphates at acidic pH through proton-sensing activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.5 kDa

References & Citations

"Identification and analysis of two splice variants of human G2A generated by alternative splicing." Ogawa A., Obinata H., Hattori T., Kishi M., Tatei K., Ishikawa O., Izumi T. J. Pharmacol. Exp. Ther. 332:469-478 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details