Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (70a.a)

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2][3][4].

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (70a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-70a-a.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Zhang R, et al. Effects of TGF-beta1 and IGF-1 on proliferation of human nucleus pulposus cells in medium with different serum concentrations. J Orthop Surg Res. 2006 Oct 26;1:9.|[3]Mingsi X, et al. Inhibitory effects of 5-heptadecylresorcinol on the proliferation of human MCF-7 breast cancer cells through modulating PI3K/Akt/mTOR pathway. Journal of Functional Foods, 2020, 69: 103946.|[4]Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPEL5 (NM_001127400) Human Over-expression Lysate
LC426782 20 µg

YPEL5 (NM_001127400) Human Over-expression Lysate

Sign In for Pricing
View Details
FBXW7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B9]
TA802871AM 100 µL

FBXW7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B9]

Sign In for Pricing
View Details
2-Ethyl-1-hexanamine
TRC-E918760-500G 500 g

2-Ethyl-1-hexanamine

Sign In for Pricing
View Details
ZNF3 antibody
FNab09682 100 µg

ZNF3 antibody

Sign In for Pricing
View Details
Archaemetzincin 2 (AMZ2) (NM_001033571) Human Over-expression Lysate
LY422397 100 µg

Archaemetzincin 2 (AMZ2) (NM_001033571) Human Over-expression Lysate

Sign In for Pricing
View Details
N-(1-Oxohexadecyl)-L-glutamic Acid tert-Butyl Ester
TRC-O870090-250MG 250 mg

N-(1-Oxohexadecyl)-L-glutamic Acid tert-Butyl Ester

Sign In for Pricing
View Details