Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Human (70a.a)

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 protein, Human (70a.a) is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2][3][4].

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Human (70a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-human-70a-a.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118) (Accession)

Molecular Weight

Approximately 8-9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.|[2]Zhang R, et al. Effects of TGF-beta1 and IGF-1 on proliferation of human nucleus pulposus cells in medium with different serum concentrations. J Orthop Surg Res. 2006 Oct 26;1:9.|[3]Mingsi X, et al. Inhibitory effects of 5-heptadecylresorcinol on the proliferation of human MCF-7 breast cancer cells through modulating PI3K/Akt/mTOR pathway. Journal of Functional Foods, 2020, 69: 103946.|[4]Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35 (13) :1467-1480.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPRT antibody
10R-5556 100 µL

QPRT antibody

Sign In for Pricing
View Details
ZBTB38 3'UTR GFP Stable Cell Line
TU078736 1.0 mL

ZBTB38 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Chloro-1-{4H,5H,6H,7H-thieno[3,2-c]pyridin-5-yl}propan-1-one
RQB78306-01 250 mg

2-Chloro-1-{4H,5H,6H,7H-thieno[3,2-c]pyridin-5-yl}propan-1-one

Sign In for Pricing
View Details
2-Chloro-1-{4H,5H,6H,7H-thieno[3,2-c]pyridin-5-yl}propan-1-one
RQB78306-02 2.5 g

2-Chloro-1-{4H,5H,6H,7H-thieno[3,2-c]pyridin-5-yl}propan-1-one

Sign In for Pricing
View Details
WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 650)
MBS6225460-01 0.1 mL

WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 650)

Sign In for Pricing
View Details
WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 650)
MBS6225460-02 5x 0.1 mL

WIPI1 (WD Repeat Domain Phosphoinositide-interacting Protein 1, WIPI-1, Atg18 Protein Homolog, WD40 Repeat Protein Interacting with Phosphoinositides of 49kD, WIPI 49kD, WIPI49) (MaxLight 650)

Sign In for Pricing
View Details