Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DR6/TNFRSF21, Mouse (HEK293, Fc-His)

The DR6/TNFRSF21 protein participates in multiple cellular processes and promotes apoptosis through NF-kappa-B activation, BAX-mediated pathways, and cytochrome c release. It is critical for neuronal apoptosis, particularly in response to APP-derived amyloid peptides, and is critical for normal cell body death and axonal pruning. DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

DR6/TNFRSF21 Protein, Mouse (HEK293, Fc-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dr6-tnfrsf21-protein-mouse-hek-293-c-fhis.html

Smiles

QPEQKTLSLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTHQQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEH

Molecular Formula

94185 (Gene_ID) Q9EPU5 (Q42-H349) (Accession)

Molecular Weight

Approximately 75-120 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF640R conjugate, 0.1mg/mL
BNC402348-500 1x 500 µL

Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details