Complement C8G, Human (His, solution)
C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. C8G/C8 γ is a neuroinflammation inhibitor that interacts with S1PR2 and jointly antagonizes the pro-inflammatory activity of S1P in microglia. Complement C8G Protein, Human (His, solution) is the recombinant human-derived Complement C8G protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Complement C8G Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-c8g-protein-human-his.html
Purity
98.0
Smiles
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Molecular Formula
733 (Gene_ID) AAI13627.1 (Q21-R202) (Accession)
Molecular Weight
Approximately 22.0-23.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HIS0131 1000 / PCK
Simport Biopsy Embedding Cassette White Single Compartment
Sign In for Pricing
View Details 
TL703477V 500 µL Each
Defb29 Rat shRNA Lentiviral Particle (Locus ID 641519)
Sign In for Pricing
View Details