Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Protein P (P), partial

Product Specifications

Abbreviation

Recombinant Hepatitis B virus genotype D subtype ayw protein P, partial

Gene Name

P

UniProt

P03156

Expression Region

336-679aa

Organism

Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)

Target Sequence

EDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional enzyme that converts the viral RNA genome into dsDNA in viral cytoplasmic capsids. This enzyme displays a DNA polymerase activity that can copy either DNA or RNA templates, and a ribonuclease H (RNase H) activity that cleaves the RNA strand of RNA-DNA heteroduplexes in a partially processive 3'- to 5'-endonucleasic mode. Neo-synthesized pregenomic RNA (pgRNA) are encapsidated together with the P protein, and reverse-transcribed inside the nucleocapsid. Initiation of reverse-transcription occurs first by binding the epsilon loop on the pgRNA genome, and is initiated by protein priming, thereby the 5'-end of (-) DNA is covalently linked to P protein. Partial (+) DNA is synthesized from the (-) DNA template and generates the relaxed circular DNA (RC-DNA) genome. After budding and infection, the RC-DNA migrates in the nucleus, and is converted into a plasmid-like covalently closed circular DNA (cccDNA) . The activity of P protein does not seem to be necessary for cccDNA generation, and is presumably released from (+) DNA by host nuclear DNA repair machinery.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.3 kDa

References & Citations

"Hepatitis B virus replication." Beck J., Nassal M. World J. Gastroenterol. 13:48-64 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934494/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-ZMPSTE24 Antibody (FITC)
STJ503602 100 µg

Anti-ZMPSTE24 Antibody (FITC)

Ask
View Details
USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (MaxLight 490)
MBS6361856-01 0.1 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (MaxLight 490)

Ask
View Details
USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (MaxLight 490)
MBS6361856-02 5x 0.1 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4) (MaxLight 490)

Ask
View Details
Heptaethylene Glycol Monododecyl Ether
TRC-H280285-500MG 500 mg

Heptaethylene Glycol Monododecyl Ether

Ask
View Details
Ociad1 (NM_001013874) Rat Tagged Lenti ORF Clone
RR202502L4 10 µg

Ociad1 (NM_001013874) Rat Tagged Lenti ORF Clone

Ask
View Details
PARVB Polyclonal Antibody
ANT-13663-50ug 50 µg

PARVB Polyclonal Antibody

Ask
View Details