Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Paired box protein Pax-8 (PAX8)

Product Specifications

Product Name Alternative

OTTHUMP00000158659; OTTHUMP00000158660; OTTHUMP00000203723; OTTHUMP00000203724; Paired box 8; Paired box gene 8; paired box homeotic gene 8; Paired box protein Pax 8; Paired box protein Pax-8; Paired domain gene 8; PAX 8; PAX8; PAX8_HUMAN

Abbreviation

Recombinant Human PAX8 protein

Gene Name

PAX8

UniProt

Q06710

Expression Region

1-450aa

Organism

Homo sapiens (Human)

Target Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.7 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927136/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-01 0.1 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details
HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-02 0.2 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details
HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-03 0.5 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details
HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-04 1 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details
HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-05 5 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details
HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)
MBS2168406-06 5x 5 mL

HRP-Linked Monoclonal Antibody to Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A)

Ask
View Details