Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2, Mouse (HEK293, His)

CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd2-protein-mouse-hek293-his.html

Purity

98.0

Smiles

RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

Molecular Formula

12481 (Gene_ID) P08920/NP_038514.1 (R23-S203) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lmbr1l 3'UTR Lenti-reporter-Luc Vector
26898084 1.0 μg

Lmbr1l 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Lentiviral mouse Gbp10 shRNA (UAS) - Lentiviral mouse Gbp10 shRNA (UAS, RFP) (100)
GTR15204792 1 Vial

Lentiviral mouse Gbp10 shRNA (UAS) - Lentiviral mouse Gbp10 shRNA (UAS, RFP) (100)

Ask
View Details
Lentiviral mouse Khdc1a shRNA (UAS) - Lentiviral mouseKhdc1a shRNA (UAS, GFP) (25)
GTR15217220 1 Vial

Lentiviral mouse Khdc1a shRNA (UAS) - Lentiviral mouseKhdc1a shRNA (UAS, GFP) (25)

Ask
View Details
Human HBB knockout cell line
ABC-KH6621 1 Vial

Human HBB knockout cell line

Ask
View Details
CACNG8 Protein Vector (Rat) (pPM-C-HA)
14906026 500 ng

CACNG8 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details