Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Goat anti-mCherry Polyclonal antibody

Goat polyclonal antibody to mCherry (Cherry fluorescent protein). mCherry protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma.

Product Specifications

CAS Number

9007-83-4

Specifications

In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody (AB0081) recognizes very well tdTomato and does not cross-react to GFP (green fluorescent protein).

Product Name Alternative

Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody

UNSPSC Description

Red Fluorescent Protein

Volume

500 µL

Host

Goat

Reactivity

mCherry, tdTomato, RFP

Immunogen

Purified recombinant peptide produced in E. coli.

Target Antigen

Purified recombinant peptide produced in E. coli.

Immunogen Type

Recombinant protein

Target

anti-mCherry

Clonality

Polyclonal

Isotype

IgG

Conjugation

Unconjugated

Type

Primary

Sequence

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Applications

WB, IF, IHC-P, IHC-F, IEM

Purification

Epitope affinity purified

Concentration

3 mg/mL

Dilution

WB:1:500-1:5,000, IF:1:50-1:500, IHC-P:1:50-1:500, IHC-F:1:50-1:500, IEM:1:50-1:500

Form

Polyclonal antibody supplied as a 200 or 500 µl (3 mg/mL) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Buffer

PBS, 20% glycerol and 0.05% sodium azide

References & Citations

1. Steenbergen VV, Burattini L, Trumpp M, et al. J Exp Med 2023 Mar. PMID: 36571760 2. Kann AP, Hung M, Wang W, et al. Cell Stem Cell 2022 May. PMID: 35597234 3. Rohrs KF, PhD Thesis, Germany, 2021 4. Lentini C, d'Orange M, Marichal N, et al. Cell Stem Cell 2021 Sep. PMID: 34592167 5. Liu X, Chen H, Wang Y, et al. Nat Commun 2021 Sep. PMID: 34580314 6. Do JL, Allahwerdy S, David RCC, et al. Invest Ophthalmol Vis Sci 2021 Jul. PMID: 34283208 7. Kremer LPM, Cerrizuela S, Dehler S, et al. Molecular Therapy-Methods 2021 Jul. PMID: 34553001 8. Stewart S, Le Bleu HK, Yette GA, et al. Development 2021 Jun. PMID: 34061172 9. Bernau K, Leet JP, Bruhn EM, et al. Am J Physiol Lung Cell Mol Physiol 2021 May. PMID: 33978489 10. Erickson EK, DaCosta AJ, Mason SC, et al. Neuropsychopharmacology 2021 Feb. PMID: 32464636 11. Hou Y, Zhang Q, Liu H, et al. Cell Rep 2021 Feb. PMID: 33567285 12. Liu H, Caballero-Florán RN, Yang T, et al. bioRxiv 2020 13. Liu H. PhD Thesis, University of Michigan, United States, 2020 14. Labus J, Röhrs KF, Ackmann J, et al. Prog Neurobiol 2020 Aug. PMID: 32841723 15. Brandalise F, Kalmbach BE, Mehta P, et al. J Neurosci 2020 May. PMID:32467357 16. Al-Saad RZ, Kerr I, Hume AN. ASSAY and Drug Development Technologies 2020 May. PMID: 32384245 17. Galegos CM. Master Thesis. University of Texas, USA 2020 18. Luo H, Liu HZ, Zhang WW, et al. Cell Rep. 2019 Nov. PMID:31747607 19. Stewart S, Le Bleu HK, Yette GA, et al. bioRxiv Oct 2019 20. Marin-Mogollon C, Salman AM, Koolen KMJ, et al. Front Cell Infect Microbiol 2019 Apr. PMID:31058097 21. Saito YC, Maejima T, Nishitani M, et al. J Neurosci 2018 Jul. PMID:29915137 22. Cattaud V, PhD Thesis, University of Tolouse, France, 2018 23. Raven AP, PhD Thesis, Edinburg University, United Kingdom, 2018 24. Saito K, Nobuhisa I, Harada K et al. Exp Cell Res 2018 Feb. PMID:29458175 25. Soya S, Takahashi TM, McHugh TJ, et al. Nat Commun 2017 Nov. PMID:29151577 26. Fiuza M, Rostosky CM, Parkinson GT, et al. J Cell Biol 2017 Aug. PMID:28855251 27. Hasegawa E, Maejima T, Yoshida T et al. Proc Natl Acad Sci U S A. 2017 Apr. PMID:28396432 28. Zhang-Hooks Y, Agarwal A, Mishina M, et al. Neuron 2016 Jan. Supplemental Information, PMID:26774161 29. Stykel MG, MSc Thesis, University of Calgary, Canada, 2016 30. Nakatsukasa K, Nishimura T, Byrne SD, et al. Mol Cell 2015 Jul. Supplemental Information, PMID: 25982115 31. Julkowska MM, McLoughlin F, Galvan-Ampudia CS, et al. Plant Cell Environ 2015 Mar. PMID: 25074439 32. Okorocha AE, PhD Thesis, University of Leicester, United Kingdom 2015 33. Déglon N, Merienne N, Genome editing for the treatment of huntington's disease, EP 2982758 A1 Patent, 2014 34. Benske A, MSc Thesis, The University of British Columbia, Canada, 2014

Storage Conditions

For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pth AAV siRNA Pooled Vector
38104166 1.0 µg

Pth AAV siRNA Pooled Vector

Ask
View Details
Substance P 1mg
A22064-1 1 mg

Substance P 1mg

Ask
View Details
TNNC1 Antibody, HRP conjugated
A37167-50UG 50 µg

TNNC1 Antibody, HRP conjugated

Ask
View Details
NOVA2 antibody - N-terminal region
MBS3205199-01 0.1 mL

NOVA2 antibody - N-terminal region

Ask
View Details
NOVA2 antibody - N-terminal region
MBS3205199-02 5x 0.1 mL

NOVA2 antibody - N-terminal region

Ask
View Details
N4BP1 Antibody
MBS9405833-01 0.1 mL

N4BP1 Antibody

Ask
View Details