Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD72, Human (Trx, His)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

Product Specifications

Product Name Alternative

CD72 Protein, Human (Trx, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd72-protein-human-n-trx-6his.html

Smiles

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC

Molecular Formula

971 (Gene_ID) P21854 (R117-C226) (Accession)

Molecular Weight

Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit KDEL Motif-Containing Protein 2 (KDELC2) ELISA Kit
MBS9934401 Inquire

Rabbit KDEL Motif-Containing Protein 2 (KDELC2) ELISA Kit

Ask
View Details
TGM1 (Transglutaminase-1, TGase-1, Protein-glutamine gamma-glutamyltransferase K, Epidermal TGase, KTG, Transglutaminase K, TGase K, TG (K), TGK) (MaxLight 550)
134393-ML550 100 µL

TGM1 (Transglutaminase-1, TGase-1, Protein-glutamine gamma-glutamyltransferase K, Epidermal TGase, KTG, Transglutaminase K, TGase K, TG (K), TGK) (MaxLight 550)

Ask
View Details
Human angiotensinogen, aGT ELISA Kit
CK-bio-10261-01 48 Tests

Human angiotensinogen, aGT ELISA Kit

Ask
View Details
Human angiotensinogen, aGT ELISA Kit
CK-bio-10261-02 96 Tests

Human angiotensinogen, aGT ELISA Kit

Ask
View Details
Human angiotensinogen, aGT ELISA Kit
CK-bio-10261-03 5x 96 Tests

Human angiotensinogen, aGT ELISA Kit

Ask
View Details
Human angiotensinogen, aGT ELISA Kit
CK-bio-10261-04 10x 96 Tests

Human angiotensinogen, aGT ELISA Kit

Ask
View Details