CD72, Human (Trx, His)
CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag.
Product Specifications
Product Name Alternative
CD72 Protein, Human (Trx, His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd72-protein-human-n-trx-6his.html
Smiles
RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Molecular Formula
971 (Gene_ID) P21854 (R117-C226) (Accession)
Molecular Weight
Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items