Animal-Free AITRL/TNFSF18, Human (His)
AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. Animal-Free AITRL/TNFSF18 Protein, Human (His) is a recombinant human AITRL (Q49-I174) with C-terminal His tag, which is expressed in E.coli.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free AITRL/TNFSF18 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-aitrl-tnfsf18-protein-human-his.html
Purity
95.0
Smiles
MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEI
Molecular Formula
8995 (Gene_ID) Q9UNG2 (Q49-I174) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Tissue culture tretaed 384 well plates, black polystyrene, with lid, sterilized
