Exendin 4 - FAM labeled

<strong>Exendin 4 - FAM labeled</strong>_x000D_ <strong>Catalog number:</strong> B2019438_x000D_ <strong>Lot number:</strong> Batch Dependent_x000D_ <strong>Expiration Date:</strong> Batch dependent_x000D_ <strong>Amount:</strong> 1 mg_x000D_ <strong>Molecular Weight or Concentration:</strong> 4545_x000D_ <strong>Supplied as:</strong> Powder_x000D_ <strong>Applications:</strong> a molecular tool for various biochemical applications_x000D_ <strong>Storage:</strong> -20°C_x000D_ <strong>Keywords:</strong> FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2_x000D_ <strong>Grade:</strong> Biotechnology grade. All products are highly pure. All solutions are made with Type I ultrapure water (resistivity &gt;18 MΩ-cm) and are filtered through 0.22 um._x000D_ _x000D_ <strong>References:</strong>_x000D_ 1: Leung K. VivoTag-S 750-(S)-2-amino-4-pentynoic acid(12)-exendin-4 2011 Nov 1 [updated 2012 Jan 5]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013._x000D_ 2: Clardy SM, Keliher EJ, Mohan JF, Sebas M, Benoist C, Mathis D, Weissleder R. Fluorescent exendin-4 derivatives for pancreatic β-cell analysis Bioconjug Chem. 2014 Jan 15;25(1):171-7._x000D_ 3: Cork SC, Richards JE, Holt MK, Gribble FM, Reimann F, Trapp S. Distribution and characterisation of Glucagon-like peptide-1 receptor expressing cells in the mouse brain Mol Metab. 2015 Aug 5;4(10):718-31._x000D_ 4: Aranäs C, Edvardsson CE, Shevchouk OT, Zhang Q, Witley S, Blid Sköldheden S, Zentveld L, Vallöf D, Tufvesson-Alm M, Jerlhag E. Semaglutide reduces alcohol intake and relapse-like drinking in male and female rats EBioMedicine. 2023 Jul;93:104642._x000D_ 5: Chicchi GG, Cascieri MA, Graziano MP, Calahan T, Tota MR. Fluorescein-Trp25-exendin-4, a biologically active fluorescent probe for the human GLP-1 receptor Peptides. 1997;18(2):319-21._x000D_ 6: Kang HM, Sohn I, Jung J, Jeong JW, Park C. Exendin-4 protects hindlimb ischemic injury by inducing angiogenesis Biochem Biophys Res Commun. 2015 Oct 2;465(4):758-63._x000D_ 7: Yan C, Ma X, Lam SM, Zhang Y, Cao Y, Dong Y, Su L, Shui G, Feng Y. Exendin-4 attenuates atherosclerosis progression via controlling hematopoietic stem/progenitor cell proliferation J Mol Cell Biol. 2023 Jun 13;15(2):mjad014._x000D_ 8: Wang L, Tang L, Wang Y, Wang L, Liu X, Liu X, Chen Z, Liu L. Exendin-4 protects HUVECs from t-BHP-induced apoptosis via PI3K/Akt-Bcl-2-caspase-3 signaling Endocr Res. 2016 Aug;41(3):229-35._x000D_ 9: Lehtonen J, Schäffer L, Rasch MG, Hecksher-Sørensen J, Ahnfelt-Rønne J. Beta cell specific probing with fluorescent exendin-4 is progressively reduced in type 2 diabetic mouse models Islets. 2015;7(6):e1137415._x000D_ <a href="https://pubmed.ncbi.nlm.nih.gov/27915415">10: Wu L, Liu X, Wang L, Wang Y, Wang L, Guan B, Chen Z, Liu L. Exendin-4 protects HUVECs from tunicamycin-induced apoptosis via inhibiting the IRE1a/JNK/caspase-3 pathway Endocrine. 2017 Mar;55(3):764-772. </a>_x000D_ _x000D_ <strong>Products Related to Exendin 4 - FAM labeled can be found at</strong> <a href="https://moleculardepot.com/product-category/Peptides/"> Peptides</a>