PSCA, Mouse (P.pastoris, His)
PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
PSCA Protein, Mouse (P.pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/psca-protein-mouse-p-pastoris-his.html
Smiles
LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
Molecular Formula
72373 (Gene_ID) P57096 (L21-N95) (Accession)
Molecular Weight
Approximately 10.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
BTN3A3, NT (BTN3A3, BTF3, Butyrophilin subfamily 3 member A3) (APC)
BTN3A3, NT (BTN3A3, BTF3, Butyrophilin subfamily 3 member A3) (APC)