Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSCA, Mouse (P.pastoris, His)

PSCA protein is a multifunctional regulator that may modulate cell proliferation and act as a modulator of nicotinic acetylcholine receptor (nAChR) activity. In vitro experiments showed that it can inhibit nicotine-induced signaling, suggesting interaction with nAChR containing α-3:β-2 or α-7. PSCA Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PSCA protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

PSCA Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psca-protein-mouse-p-pastoris-his.html

Smiles

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Molecular Formula

72373 (Gene_ID) P57096 (L21-N95) (Accession)

Molecular Weight

Approximately 10.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1110004F10Rik (NM_019772) Mouse Tagged ORF Clone
MG201626 10 µg

1110004F10Rik (NM_019772) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Copz1 (NM_019817) Mouse Tagged ORF Clone
MG201552 10 µg

Copz1 (NM_019817) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]
E-AB-F1384J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]
E-AB-F1384J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]
E-AB-F1384J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD94 Antibody[DX22]

Sign In for Pricing
View Details
Camostat Mesylate
TRC-C150300-2.5G 2.5 g

Camostat Mesylate

Sign In for Pricing
View Details