Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRASP shRNA Plasmid (h)

Product Specifications

No additional specifications available.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse IgG2b (MPC-11) Isotype Control for In Vivo - Low Endotoxin
ICH2250-5mg 5 mg

Mouse IgG2b (MPC-11) Isotype Control for In Vivo - Low Endotoxin

Ask
View Details
TRIP10 (Cdc42-interacting Protein 4, Protein Felic, Salt Tolerant Protein, hSTP, Thyroid Receptor-interacting Protein 10, TR-interacting Protein 10, TRIP-10, CIP4, STOT, STP) (MaxLight 650)
MBS6225222-01 0.1 mL

TRIP10 (Cdc42-interacting Protein 4, Protein Felic, Salt Tolerant Protein, hSTP, Thyroid Receptor-interacting Protein 10, TR-interacting Protein 10, TRIP-10, CIP4, STOT, STP) (MaxLight 650)

Ask
View Details
TRIP10 (Cdc42-interacting Protein 4, Protein Felic, Salt Tolerant Protein, hSTP, Thyroid Receptor-interacting Protein 10, TR-interacting Protein 10, TRIP-10, CIP4, STOT, STP) (MaxLight 650)
MBS6225222-02 5x 0.1 mL

TRIP10 (Cdc42-interacting Protein 4, Protein Felic, Salt Tolerant Protein, hSTP, Thyroid Receptor-interacting Protein 10, TR-interacting Protein 10, TRIP-10, CIP4, STOT, STP) (MaxLight 650)

Ask
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Ask
View Details
Thra Rabbit Polyclonal Antibody
TA363015 100 µL

Thra Rabbit Polyclonal Antibody

Ask
View Details
PROX2 Lentiviral Activation Particles (m)
sc-428567-LAC 200 µL

PROX2 Lentiviral Activation Particles (m)

Ask
View Details