Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin alpha-4 (ITGA4), partial

Product Specifications

Product Name Alternative

(CD49 antigen-like family member D) (Integrin alpha-IV) (VLA-4 subunit alpha) (CD antigen CD49d)

Abbreviation

Recombinant Human ITGA4 protein, partial

Gene Name

ITGA4

UniProt

P13612

Expression Region

376-558aa

Organism

Homo sapiens (Human)

Target Sequence

GDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCR

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4:ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGA4:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.5 kDa

References & Citations

"Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins alphavbeta3, alpha4beta1, and alpha5beta1." Fujita M., Zhu K., Fujita C.K., Zhao M., Lam K.S., Kurth M.J., Takada Y.K., Takada Y. J. Biol. Chem. 290:259-271 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SLC19A1 Antibody
E38QA5910 100 µL

SLC19A1 Antibody

Ask
View Details
PLAGL1 CytoSection
TS416984P5 25 Slides

PLAGL1 CytoSection

Ask
View Details
Mouse Monoclonal Fascin Antibody (FSCN1/418) [Alexa Fluor 700]
NBP2-47802AF700 0.1 mL

Mouse Monoclonal Fascin Antibody (FSCN1/418) [Alexa Fluor 700]

Ask
View Details
Myelin Basic Protein (68-82), guinea pig 1mg
A14881-1 1 mg

Myelin Basic Protein (68-82), guinea pig 1mg

Ask
View Details
CYP2R1, CT (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (MaxLight 650)
MBS6471621-01 0.1 mL

CYP2R1, CT (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (MaxLight 650)

Ask
View Details
CYP2R1, CT (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (MaxLight 650)
MBS6471621-02 5x 0.1 mL

CYP2R1, CT (Vitamin D 25-hydroxylase, Cytochrome P450 2R1) (MaxLight 650)

Ask
View Details