Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 5A, mitochondrial (Cox5a)

Product Specifications

Product Name Alternative

(Cytochrome c oxidase polypeptide Va)

Abbreviation

Recombinant Mouse Cox5a protein

Gene Name

Cox5a

UniProt

P12787

Expression Region

38-146aa

Organism

Mus musculus (Mouse)

Target Sequence

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU (A) ) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU (B) ) . The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.4 kDa

References & Citations

"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933854/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Gsr (Glutathione reductase) QuickTest ELISA Kit
QT-ER0631 96 Tests

Rat Gsr (Glutathione reductase) QuickTest ELISA Kit

Ask
View Details
HSZFP36 antibody
MBS834873-01 0.1 mL

HSZFP36 antibody

Ask
View Details
HSZFP36 antibody
MBS834873-02 5x 0.1 mL

HSZFP36 antibody

Ask
View Details
Rabbit anti-ATXN7L3 Antibody, Affinity Purified
A302-800A-T 10 µg

Rabbit anti-ATXN7L3 Antibody, Affinity Purified

Ask
View Details
FXR2 (FMR1L2, Fragile X Mental Retardation Syndrome-related Protein 2) (HRP)
MBS6379058-01 0.1 mL

FXR2 (FMR1L2, Fragile X Mental Retardation Syndrome-related Protein 2) (HRP)

Ask
View Details
FXR2 (FMR1L2, Fragile X Mental Retardation Syndrome-related Protein 2) (HRP)
MBS6379058-02 5x 0.1 mL

FXR2 (FMR1L2, Fragile X Mental Retardation Syndrome-related Protein 2) (HRP)

Ask
View Details