Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CELA2A, Mouse (His)

CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CELA2A Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cela2a-protein-mouse-his.html

Smiles

VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Molecular Formula

13706 (Gene_ID) P05208 (V31-N271) (Accession)

Molecular Weight

Approximately 29.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sod1 Rat Pre-designed siRNA Set A
HY-RS23369 1 Set

Sod1 Rat Pre-designed siRNA Set A

Ask
View Details
SNORA8 ORF Vector (Human) (pORF)
44667011 1.0 µg DNA

SNORA8 ORF Vector (Human) (pORF)

Ask
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) THOC6 Polyclonal Antibody
MBS9014996 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) THOC6 Polyclonal Antibody

Ask
View Details
Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit
MBS020245-01 48 Well

Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit

Ask
View Details
Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit
MBS020245-02 96 Well

Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit

Ask
View Details
Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit
MBS020245-03 5x 96 Well

Mouse P53 Upregulated Modulator of Apoptosis ELISA Kit

Ask
View Details