CELA2A, Mouse (His)
CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CELA2A Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cela2a-protein-mouse-his.html
Smiles
VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Molecular Formula
13706 (Gene_ID) P05208 (V31-N271) (Accession)
Molecular Weight
Approximately 29.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6131315-01 0.1 mL
UBA6 (Ubiquitin-like Modifier-activating Enzyme 6, Ubiquitin Activating Enzyme 6, E1-L2, FLJ10808, FLJ23367, Monocyte Protein 4, MOP4, MOP-4, Ubiquitin-activating Enzyme E1-like Protein 2, UBE1L2, FLJ10808, FLJ23367, MOP-4, UBE1L2) (AP)
Ask
View Details