Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

Product Specifications

Product Name Alternative

Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein (RIG-E) ; Stem cell antigen 2 (SCA-2) ; Thymic shared antigen 1 (TSA-1) ; LY6E; 9804, RIGE, SCA2, TSA1

Abbreviation

Recombinant Human LY6E protein (Active)

Gene Name

LY6E

UniProt

Q16553

Expression Region

21-101aa

Organism

Homo sapiens (Human)

Target Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Tag

N-terminal hFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU) . The EC50 is 2.483-3.282 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.6 kDa

References & Citations

Innovative biomarkers TCN2 and LY6E can significantly inhibit respiratory syncytial virus infection. Cao B., Li M., Li X., Ji X., Wan L., Jiang Y., Zhou L., Gong F., Chen X. J Transl Med 22:854-854 (2024)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12936658/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (PE)
MBS6159241-01 0.1 mL

OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (PE)

Ask
View Details
OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (PE)
MBS6159241-02 5x 0.1 mL

OTUB2 (Ubiquitin Thioesterase OTUB2, Deubiquitinating Enzyme OTUB2, OTU Domain-containing Ubiquitin Aldehyde-binding Protein 2, Otubain-2, Ubiquitin-specific-processing Protease OTUB2, C14orf137, OTB2, OTU2, FLJ21916, MGC3102) (PE)

Ask
View Details
Dolutegravir Sodium Salt
TRC-D528805-100MG 100 mg

Dolutegravir Sodium Salt

Ask
View Details
Multiple parts of skin squamous cell carcinoma tissue array with normal tissues as control, including pathology grade, 48 cases/48 cores
SK483 1 Each

Multiple parts of skin squamous cell carcinoma tissue array with normal tissues as control, including pathology grade, 48 cases/48 cores

Ask
View Details
Rabbit Polyclonal GMF-beta Antibody [DyLight 650]
NBP3-00104C 0.1 mL

Rabbit Polyclonal GMF-beta Antibody [DyLight 650]

Ask
View Details