Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVRL1/ALK1, Mouse (HEK293, His-Fc)

ALK-1, also known as ACVRL1, is a type I receptor for TGF-β superfamily with 2 ligands, BMP9 and BMP10. ALK-1 is predominantly expressed in endothelial cells and plays a critical role in regulating developmental and pathological angiogenesis[1][2]. ACVRL1/ALK1 Protein, Mouse (HEK293, His-Fc) is produced in HEK293 cells with a C-Terminal His-tag and a C-Terminal Fc-tag.

Product Specifications

Product Name Alternative

ACVRL1/ALK1 Protein, Mouse (HEK293, His-Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/alk-1-protein-mouse-hek293-his-fc.html

Purity

95.0

Smiles

MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLP

Molecular Formula

11482 (Gene_ID) Q61288 (D23-P119) (Accession)

Molecular Weight

50-55 kDa

References & Citations

[1]S P Oh, et al. Activin receptor-like kinase 1 modulates transforming growth factor-beta 1 signaling in the regulation of angiogenesis. Proc Natl Acad Sci U S A. 2000 Mar 14;97 (6) :2626-31.|[2]Dianyuan Zhao, et al. ALK1 signaling is required for the homeostasis of Kupffer cells and prevention of bacterial infection. J Clin Invest. 2022 Feb 1;132 (3) :e150489.|[3]Dianne Mitchell, et al. ALK1-Fc inhibits multiple mediators of angiogenesis and suppresses tumor growth. Mol Cancer Ther. 2010 Feb;9 (2) :379-88.|[4]Dongxing Zhu, et al. BMP-9 regulates the osteoblastic differentiation and calcification of vascular smooth muscle cells through an ALK1 mediated pathway. J Cell Mol Med. 2015 Jan;19 (1) :165-74.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Focal Adhesion Kinase Antibody
E51A14437 100 µL

Focal Adhesion Kinase Antibody

Ask
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-01 50 µg

Recombinant Human YWHAH Protein, N-His

Ask
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-02 100 µg

Recombinant Human YWHAH Protein, N-His

Ask
View Details
Recombinant Human YWHAH Protein, N-His
HC326012-03 1 mg

Recombinant Human YWHAH Protein, N-His

Ask
View Details
Merestinib (LY2801653)
205526 10.0mg

Merestinib (LY2801653)

Ask
View Details
Upk2-set siRNA/shRNA/RNAi Lentivector (Mouse)
49216094 4 x 500 ng

Upk2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details