Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat (CHO)

EGF Protein, Rat (CHO) is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat-cho.html

Purity

95.0

Smiles

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522 (N974-R1026) (Accession)

Molecular Weight

Approximately 6 kDa

References & Citations

[1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (FITC)
MBS6121370-01 0.2 mL

ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (FITC)

Ask
View Details
ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (FITC)
MBS6121370-02 5x 0.2 mL

ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (FITC)

Ask
View Details
Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag
049347-01 10 µg

Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag

Ask
View Details
Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag
049347-02 50 µg

Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag

Ask
View Details
Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag
049347-03 100 µg

Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag

Ask
View Details
Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag
049347-04 200 µg

Kringle Containing Transmembrane Protein 1 (KREMEN1), Recombinant, Human, His-Tag

Ask
View Details