Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ribonuclease E (rne), partial

Product Specifications

Product Name Alternative

(RNase E)

Abbreviation

Recombinant E.coli rne protein, partial

Gene Name

Rne

UniProt

P21513

Expression Region

35-125aa

Organism

Escherichia coli (strain K12)

Target Sequence

EQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Endoribonuclease that plays a central role in RNA processing and decay. Required for the maturation of 5S and 16S rRNAs and the majority of tRNAs. Also involved in the degradation of most mRNAs. Can also process other RNA species, such as RNAI, a molecule that controls the replication of ColE1 plasmid, and the cell division inhibitor DicF-RNA. It initiates the decay of RNAs by cutting them internally near their 5'-end. It is able to remove poly (A) tails by an endonucleolytic process. Required to initiate rRNA degradation during both starvation and quality control; acts after RNase PH (rph) exonucleolytically digests the 3'-end of the 16S rRNA . Degradation of 16S rRNA leads to 23S rRNA degradation . Processes the 3 tRNA (Pro) precursors immediately after the 3'-CCA to generate the mature ends . Prefers 5'-monophosphorylated substrates over 5'-triphosphorylated substrates . 5'-monophosphate-assisted cleavage requires at least 2 and preferably 3 or more unpaired 5'-terminal nucleotides. The optimal spacing between the 5' end and the scissile phosphate appears to be 8 nucleotides. Any sequence of unpaired nucleotides at the 5'-end is tolerated .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.1 kDa

References & Citations

"Structure of Escherichia coli RNase E catalytic domain and implications for RNA turnover." Callaghan A.J., Marcaida M.J., Stead J.A., McDowall K.J., Scott W.G., Luisi B.F. Nature 437:1187-1191 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933362/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ank1 Mouse siRNA Oligo Duplex (Locus ID 11733)
SR423273 1 Kit

Ank1 Mouse siRNA Oligo Duplex (Locus ID 11733)

Ask
View Details
NEFL Antibody, FITC conjugated
A29603-50UG 50 µg

NEFL Antibody, FITC conjugated

Ask
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_35105 Polyclonal Antibody
MBS9003842 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) OsI_35105 Polyclonal Antibody

Ask
View Details
ARFIP1 (NM_001287433) Human Untagged Clone
SC335472 10 µg

ARFIP1 (NM_001287433) Human Untagged Clone

Ask
View Details