Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-36 beta protein (IL36B) (Active)

Product Specifications

Product Name Alternative

FIL1 eta, IL-1 eta, Interleukin-1 family member 8, IL-1F8, Interleukin-1 homolog 2

Abbreviation

Recombinant Human IL36B protein (Active)

Gene Name

IL36B

UniProt

Q9NZH7

Expression Region

1-157aa

Organism

Homo sapiens (Human)

Target Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. {ECO:0000269|PubMed:16646978, ECO:0000269|PubMed:20300079, ECO:0000269|PubMed:21242515, ECO:0000269|PubMed:21881584, ECO:0000269|PubMed:21965679, ECO:0000269|PubMed:24829417}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36β at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensins 4 and 103 as well as a number of matrix metalloproteases. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6.

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11098339/

Protein Length

Full Length of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human/Mouse PKA RII alpha MAb (Clone 2394D)
MAB8000-100 100 µg

Human/Mouse PKA RII alpha MAb (Clone 2394D)

Ask
View Details
Rabbit Monoclonal Kallikrein 11 Antibody (101) [mFluor Violet 500 SE]
NBP2-89629MFV500 0.1 mL

Rabbit Monoclonal Kallikrein 11 Antibody (101) [mFluor Violet 500 SE]

Ask
View Details
PSMD2 (26S Proteasome non-ATPase Regulatory Subunit 2, 26S Proteasome Regulatory Subunit RPN1, 26S Proteasome Regulatory Subunit S2, 26S Proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-associated Protein 2, TRAP2) (HRP)
MBS6154403-01 0.1 mL

PSMD2 (26S Proteasome non-ATPase Regulatory Subunit 2, 26S Proteasome Regulatory Subunit RPN1, 26S Proteasome Regulatory Subunit S2, 26S Proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-associated Protein 2, TRAP2) (HRP)

Ask
View Details
PSMD2 (26S Proteasome non-ATPase Regulatory Subunit 2, 26S Proteasome Regulatory Subunit RPN1, 26S Proteasome Regulatory Subunit S2, 26S Proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-associated Protein 2, TRAP2) (HRP)
MBS6154403-02 5x 0.1 mL

PSMD2 (26S Proteasome non-ATPase Regulatory Subunit 2, 26S Proteasome Regulatory Subunit RPN1, 26S Proteasome Regulatory Subunit S2, 26S Proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-associated Protein 2, TRAP2) (HRP)

Ask
View Details
RASSF8 (NM_007211) Human Tagged Lenti ORF Clone
RC206104L3 10 µg

RASSF8 (NM_007211) Human Tagged Lenti ORF Clone

Ask
View Details