Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ninjurin-1 (Ninj1)

Product Specifications

Product Name Alternative

(Nerve injury-induced protein 1)

Abbreviation

Recombinant Mouse Ninj1 protein

Gene Name

Ninj1

UniProt

O70131

Expression Region

1-152aa

Organism

Mus musculus (Mouse)

Target Sequence

MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Neuroscience

Relevance

[Ninjurin-1]: Homophilic transmembrane adhesion molecule involved in various processes such as inflammation, cell death, axonal growth, cell chemotaxis and angiogenesis. Promotes cell adhesion by mediating homophilic interactions via its extracellular N-terminal adhesion motif (N-NAM) . Involved in the progression of the inflammatory stress by promoting cell-to-cell interactions between immune cells and endothelial cells. Involved in leukocyte migration during inflammation by promoting transendothelial migration of macrophages via homotypic binding. Promotes the migration of monocytes across the brain endothelium to central nervous system inflammatory lesions. Acts as a regulator of Toll-like receptor 4 (TLR4) signaling triggered by lipopolysaccharide (LPS) during systemic inflammation; directly binds LPS. Acts as a mediator of both programmed and necrotic cell death. Plays a key role in the induction of plasma membrane rupture during programmed and necrotic cell death: oligomerizes in response to death stimuli to mediate plasma membrane rupture (cytolysis), leading to release intracellular molecules named damage-associated molecular patterns (DAMPs) that propagate the inflammatory response. Plays a role in nerve regeneration by promoting maturation of Schwann cells. Acts as a regulator of angiogenesis. Promotes the formation of new vessels by mediating the interaction between capillary pericyte cells and endothelial cells. Also mediates vascular functions in penile tissue as well as vascular formation. Promotes osteoclasts development by enhancing the survival of prefusion osteoclasts. Also involved in striated muscle growth and differentiation. Also involved in cell senescence in a p53/TP53 manner, possibly by acting as an indirect regulator of p53/TP53 mRNA translation.; [Secreted ninjurin-1]: Secreted form generated by cleavage, which has chemotactic activity. Acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.1 kDa

References & Citations

"The N-terminal ectodomain of Ninjurin1 liberated by MMP9 has chemotactic activity." Ahn B.J., Le H., Shin M.W., Bae S.J., Lee E.J., Wee H.J., Cha J.H., Park J.H., Lee H.S., Lee H.J., Jung H., Park Z.Y., Park S.H., Han B.W., Seo J.H., Lo E.H., Kim K.W. Biochem. Biophys. Res. Commun. 428:438-444 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/11123554/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1518) [mFluor Violet 450 SE]
NBP2-54414MFV450 0.1 mL

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1518) [mFluor Violet 450 SE]

Ask
View Details
Rat Aldo keto reductase family 1 member C like protein 1 (AKR1CL1) ELISA Kit
E02A1375-01 48 Well

Rat Aldo keto reductase family 1 member C like protein 1 (AKR1CL1) ELISA Kit

Ask
View Details
Rat Aldo keto reductase family 1 member C like protein 1 (AKR1CL1) ELISA Kit
E02A1375-02 96 Well

Rat Aldo keto reductase family 1 member C like protein 1 (AKR1CL1) ELISA Kit

Ask
View Details
Cell Death Activator CIDE-A (CIDEA) Antibody
abx006244-01 60 µL

Cell Death Activator CIDE-A (CIDEA) Antibody

Ask
View Details
Cell Death Activator CIDE-A (CIDEA) Antibody
abx006244-02 120 µL

Cell Death Activator CIDE-A (CIDEA) Antibody

Ask
View Details
Cell Death Activator CIDE-A (CIDEA) Antibody
abx006244-03 200 µL

Cell Death Activator CIDE-A (CIDEA) Antibody

Ask
View Details