Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Palmitoyltransferase ZDHHC5 (ZDHHC5), partial

Product Specifications

Product Name Alternative

(Zinc finger DHHC domain-containing protein 5) (DHHC-5) (Zinc finger protein 375)

Abbreviation

Recombinant Human ZDHHC5 protein, partial

Gene Name

ZDHHC5

UniProt

Q9C0B5

Expression Region

60-148aa

Organism

Homo sapiens (Human)

Target Sequence

ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates such as CTNND2, CD36, STAT3 and S1PR1 thus plays a role in various biological processes including cell adhesion, fatty acid uptake, bacterial sensing or cardiac functions. Plays an important role in the regulation of synapse efficacy by mediating palmitoylation of delta-catenin/CTNND2, thereby increasing synaptic delivery and surface stabilization of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptors (AMPARs) . Under basal conditions, remains at the synaptic membrane through FYN-mediated phosphorylation that prevents association with endocytic proteins. Neuronal activity enhances the internalization and trafficking of DHHC5 from spines to dendritic shafts where it palmitoylates delta-catenin/CTNND2. Regulates cell adhesion at the plasma membrane by palmitoylating GOLGA7B and DSG2. Plays a role in innate immune response by mediating the palmitoylation of NOD1 and NOD2 and their proper recruitment to the bacterial entry site and phagosomes. Participates also in fatty acid uptake by palmitoylating CD36 and thereby targeting it to the plasma membrane. Upon binding of fatty acids to CD36, gets phosphorylated by LYN leading to inactivation and subsequent CD36 caveolar endocytosis. Controls oligodendrocyte development by catalyzing STAT3 palmitoylation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.6 kDa

References & Citations

"Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase." Kokkola T., Kruse C., Roy-Pogodzik E.M., Pekkinen J., Bauch C., Honck H.H., Hennemann H., Kreienkamp H.J. FEBS Lett. 585:2665-2670 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932632/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Adenosine Receptor A2a (ADORA2A) (NM_000675) Human Untagged Clone
SC119757 10 µg

Adenosine Receptor A2a (ADORA2A) (NM_000675) Human Untagged Clone

Ask
View Details
SULT1C2 protein (His tag)
80R-1600 100 ug

SULT1C2 protein (His tag)

Ask
View Details
Recombinant Human RAGE-1/MOK Protein, N-His-SUMO
YHJ83002 100 μg

Recombinant Human RAGE-1/MOK Protein, N-His-SUMO

Ask
View Details
EIF3K Antibody (C-term)
E45M05865G-4 50 ul

EIF3K Antibody (C-term)

Ask
View Details
DMT-dG(ib) Phosphoramidite
HY-W008848-01 5 g

DMT-dG(ib) Phosphoramidite

Ask
View Details
DMT-dG(ib) Phosphoramidite
HY-W008848-02 10 g

DMT-dG(ib) Phosphoramidite

Ask
View Details