Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Non-structural maintenance of chromosomes element 3 homolog (NSMCE3)

Product Specifications

Product Name Alternative

Hepatocellular carcinoma-associated protein 4 MAGE-G1 antigen Melanoma-associated antigen G1 Necdin-like protein 2

Abbreviation

Recombinant Human NSMCE3 protein

Gene Name

NSMCE3

UniProt

Q96MG7

Expression Region

1-304aa

Organism

Homo sapiens (Human)

Target Sequence

MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination (PubMed:20864041, PubMed:27427983) . The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs) . In vitro enhances ubiquitin ligase activity of NSMCE1. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex (PubMed:20864041) . May be a growth suppressor that facilitates the entry of the cell into cell cycle arrest (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.4 kDa

References & Citations

"Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families." Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. PLoS ONE 6:E17270-E17270 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929232/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FERD3L (NM_152898) Human Tagged Lenti ORF Clone
RC223194L3 10 µg

FERD3L (NM_152898) Human Tagged Lenti ORF Clone

Ask
View Details
Lrrc4b (NM_001271081) Rat Tagged ORF Clone
RR217130 10 µg

Lrrc4b (NM_001271081) Rat Tagged ORF Clone

Ask
View Details
SREBP-1 (Acetyl-Lys324) Polyclonal Antibody
UB-GEN-4334 100 ul

SREBP-1 (Acetyl-Lys324) Polyclonal Antibody

Ask
View Details
Bovine Plasma Triacylglycerides, TAG ELISA KIT
E0414Bo-01 48 Well

Bovine Plasma Triacylglycerides, TAG ELISA KIT

Ask
View Details
Bovine Plasma Triacylglycerides, TAG ELISA KIT
E0414Bo-02 96 Well

Bovine Plasma Triacylglycerides, TAG ELISA KIT

Ask
View Details
Bovine Plasma Triacylglycerides, TAG ELISA KIT
E0414Bo-03 5x 96 Tests

Bovine Plasma Triacylglycerides, TAG ELISA KIT

Ask
View Details