Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR gamma, Human (His)

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

Product Specifications

Product Name Alternative

PPAR gamma Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppar-gamma-lbd-protein-human-his.html

Purity

96.00

Smiles

DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Formula

5468 (Gene_ID) P37231-1 (D238-D503) (Accession)

Molecular Weight

Approximately 30-32.6 kDa

References & Citations

[1]Changying Yu, et al.Binding analyses between Human PPARgamma-LBD and ligands. Eur J Biochem. 2004 Jan;271 (2) :386-97|[2]Jun Young Jang, et al. Structural Basis for the Enhanced Anti-Diabetic Efficacy of Lobeglitazone on PPARγ. Sci Rep. 2018 Jan 8;8 (1) :31.|[3]Ye J, et al., Natural flavonoid glycosides Chrysosplenosides I & A rejuvenate intestinal stem cell aging via activation of PPARγ signaling. Life Med. 2024 Jun 28;3 (3) :lnae025.|[4]Ma Y, et al., 18:0 Lyso PC, a natural product with potential PPAR-γ agonistic activity, plays hypoglycemic effect with lower liver toxicity and cardiotoxicity in db/db mice. Biochem Biophys Res Commun. 2021 Nov 19;579:168-174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dipeptidylpeptidase 10 Antibody
45-480 0.1 mg

Dipeptidylpeptidase 10 Antibody

Ask
View Details
Vacuolar fusion protein MON1 homolog B (MON1B) Human ELISA Kit
I1814 96 Tests

Vacuolar fusion protein MON1 homolog B (MON1B) Human ELISA Kit

Ask
View Details
Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)
MBS1162511-01 0.05 mg (E-Coli)

Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)
MBS1162511-02 0.05 mg (Yeast)

Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)
MBS1162511-03 0.05 mg (Baculovirus)

Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)

Ask
View Details
Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)
MBS1162511-04 0.2 mg (E-Coli)

Recombinant Staphylococcus aureus ATP synthase subunit beta (atpD)

Ask
View Details