Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Rat

FGF-18 Protein, Rat is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Product Specifications

Product Name Alternative

FGF-18 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-rat.html

Purity

95.00

Smiles

EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSR

Molecular Formula

29369 (Gene_ID) O88182 (E28-R199) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)
MBS7010248-01 0.02 mg

Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)

Ask
View Details
Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)
MBS7010248-02 0.1 mg

Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)

Ask
View Details
Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)
MBS7010248-03 5x 0.1 mg

Recombinant Triticum aestivum ATP synthase subunit a, chloroplastic (atpI)

Ask
View Details
Recombinant Human Actin-like protein 10 (ACTL10)
MBS1351027-01 0.02 mg (E-Coli)

Recombinant Human Actin-like protein 10 (ACTL10)

Ask
View Details
Recombinant Human Actin-like protein 10 (ACTL10)
MBS1351027-02 0.1 mg (E-Coli)

Recombinant Human Actin-like protein 10 (ACTL10)

Ask
View Details
Recombinant Human Actin-like protein 10 (ACTL10)
MBS1351027-03 0.02 mg (Yeast)

Recombinant Human Actin-like protein 10 (ACTL10)

Ask
View Details