Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Product Specifications

Product Name Alternative

Zinc finger CCHC domain-containing protein 1

Abbreviation

Recombinant Human LIN28A protein, partial

Gene Name

LIN28A

UniProt

Q9H9Z2

Expression Region

39-112aa

Organism

Homo sapiens (Human)

Target Sequence

HGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism . Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (Probable) . 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression. Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 AND tut7 uridylyltransferaseS. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells . Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

9.5 kDa

References & Citations

"Lin28-mediated control of let-7 microRNA expression by alternative TUTases Zcchc11 (TUT4) and Zcchc6 (TUT7) ." Thornton J.E., Chang H.M., Piskounova E., Gregory R.I. RNA 18:1875-1885 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933034/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Osteocalcin/Bone gla protein, OT/BGP ELISA kit
YLA1183HU-01 48 Tests

Human Osteocalcin/Bone gla protein, OT/BGP ELISA kit

Ask
View Details
Human Osteocalcin/Bone gla protein, OT/BGP ELISA kit
YLA1183HU-02 96 Tests

Human Osteocalcin/Bone gla protein, OT/BGP ELISA kit

Ask
View Details
NME4 Antibody - middle region: HRP (ARP56611_P050-HRP)
ARP56611_P050-HRP 100 µL

NME4 Antibody - middle region: HRP (ARP56611_P050-HRP)

Ask
View Details
Magic™ Membrane Protein Human OR9Q1 (Olfactory receptor family 9 subfamily Q member 1) Full Length
MPC3175K Each

Magic™ Membrane Protein Human OR9Q1 (Olfactory receptor family 9 subfamily Q member 1) Full Length

Ask
View Details
CDC37L1 Rabbit Polyclonal Antibody
E10G08138 100 μl

CDC37L1 Rabbit Polyclonal Antibody

Ask
View Details
CFD CRISPR All-in-one AAV vector set (with saCas9)(Rat)
15969156 3x1.0μg DNA

CFD CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details