Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein E (Apoe)

Product Specifications

Product Name Alternative

Apo-E

Abbreviation

Recombinant Mouse Apoe protein

Gene Name

Apoe

UniProt

P08226

Expression Region

19-311aa

Organism

Mus musculus (Mouse)

Target Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

APOE knockout mice display severe hypercholesterolemia associated with impaired clearance of dietary fats. Excess cholesterol is more particularly associated with the atherogenic very low and intermediate density lipoproteins in the plasma. These mice are therefore prone to atherosclerosis. Animals with a double knockout of APOE and CD36, fed a Western diet for 12 weeks, exhibit much lower levels of CXCL1, CXCL2 and CCL5 mRNA expression in the descending aorta and a corresponding decrease in atherosclerotic lesion formation, compared to APOE single knockout mice. Animals with a double knockout of APOE and TLR4 or TLR6 also have less aortic plaque formation than single knockout mice. All 3 double knockout show lower serum concentrations of IL1A, ILB and IL18.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.9 kDa

References & Citations

"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Prostaglandin E1, PG-E1 ELISA Kit
MBS9302623-01 48 Well

Rat Prostaglandin E1, PG-E1 ELISA Kit

Ask
View Details
Rat Prostaglandin E1, PG-E1 ELISA Kit
MBS9302623-02 96 Well

Rat Prostaglandin E1, PG-E1 ELISA Kit

Ask
View Details
Rat Prostaglandin E1, PG-E1 ELISA Kit
MBS9302623-03 5x 96 Well

Rat Prostaglandin E1, PG-E1 ELISA Kit

Ask
View Details
Rat Prostaglandin E1, PG-E1 ELISA Kit
MBS9302623-04 10x 96 Well

Rat Prostaglandin E1, PG-E1 ELISA Kit

Ask
View Details
Pulsating Airflow Accessories (User Can Be Retrofitted) for Fluid Bed Dryers
1215890 1 PC

Pulsating Airflow Accessories (User Can Be Retrofitted) for Fluid Bed Dryers

Ask
View Details
ADAMTS1 (A Disintegrin And Metalloproteinase with ThromboSpondin-1 motif, METH-1)
A0859-57D 50 µg

ADAMTS1 (A Disintegrin And Metalloproteinase with ThromboSpondin-1 motif, METH-1)

Ask
View Details