Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45B, Human (His)

GADD45B Protein, a pivotal mediator, regulates growth and apoptosis by activating the MTK1/MEKK4 MAPKKK signaling pathway. Interacting with GADD45GIP1, it forms a complex that modulates cellular responses under stress. Its central role in growth and apoptosis underscores its significance in orchestrating cellular processes, positioning GADD45B as a key player in the intricate network of signaling pathways governing cell fate decisions. GADD45B Protein, Human (His) is the recombinant human-derived GADD45B protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45b-protein-human-his.html

Purity

98.0

Smiles

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER

Molecular Formula

4616 (Gene_ID) O75293 (M1-R160) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FoxP1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-10816 0.1 mg

FoxP1 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Claudin domain-containing protein 2 (CLDND2) Human ELISA Kit
C3971 96 Tests

Claudin domain-containing protein 2 (CLDND2) Human ELISA Kit

Ask
View Details
Riok1 (BC002158) Mouse Tagged Lenti ORF Clone
MR204785L3 10 µg

Riok1 (BC002158) Mouse Tagged Lenti ORF Clone

Ask
View Details
XAGE2 Polyclonal Antibody, Cy5 Conjugated
bs-7017R-Cy5 100 µL

XAGE2 Polyclonal Antibody, Cy5 Conjugated

Ask
View Details
Neuropilin-2, CT (K813) (NRP2, VEGF165R2, Neuropilin-2, Vascular endothelial cell growth factor 165 receptor 2) (MaxLight 550) discontinued
038920-ML550 100 µL

Neuropilin-2, CT (K813) (NRP2, VEGF165R2, Neuropilin-2, Vascular endothelial cell growth factor 165 receptor 2) (MaxLight 550) discontinued

Ask
View Details