Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6, Canine

IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-6 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6-protein-canine.html

Purity

98.0

Smiles

TPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM

Molecular Formula

403985 (Gene_ID) P41323 (T23-M207) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nori® Feline 2-Plex ELISA Kits-IL2/IL4
GR227122 96 Well

Nori® Feline 2-Plex ELISA Kits-IL2/IL4

Ask
View Details
Nkiras2 (NM_001105839) Rat Tagged Lenti ORF Clone
RR203740L3 10 µg

Nkiras2 (NM_001105839) Rat Tagged Lenti ORF Clone

Ask
View Details
ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (HRP)
122958-HRP 100 µL

ACYP1 (Acylphosphatase-1, Acylphosphatase Erythrocyte Isozyme, ACYPE, Acylphosphatase Organ-common Type Isozyme, Acylphosphate Phosphohydrolase 1) (HRP)

Ask
View Details
KCNK3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-6674R-BF488 100 µL

KCNK3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details
MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (MaxLight 650) discontinued
M4141-01-ML650 100 µL

MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (MaxLight 650) discontinued

Ask
View Details