Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Pre-formed Fibrils

Product Specifications

Background

Human alpha synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse α-syn pathology (1). A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after single unilateral injection into the dorsal striatum in mice (4). Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.

Product Name Alternative

Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG

UNSPSC

12352202

Swiss Prot

P37840-1

Host

E. coli

Origin Species

Human

Target

Alpha Synuclein TNG (A53T, S87N, N103G)

Conjugation

No Tag

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Applications

WB, In vivo Assay, In vitro Assay

Purification Method

Ion-exchange Purified

Concentration

2 mg/ml or 5 mg/ml

Purity

>95%

Weight

0.05

Length

Full length (1 - 140 aa)

Buffer

1X PBS pH7.4

Molecular Weight

14.46 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-503.

References & Citations

1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/braiwt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.054

Product MSDS

https://cdn.gentaur.com/products/400/51210136/msds/spr-504e.pdf

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DOT1L1 shRNA (m) Lentiviral Particles
sc-77175-V 200 µL

DOT1L1 shRNA (m) Lentiviral Particles

Ask
View Details
Dinitolmide Impurity 3
RM-D341003-01 10 mg

Dinitolmide Impurity 3

Ask
View Details
Dinitolmide Impurity 3
RM-D341003-02 25 mg

Dinitolmide Impurity 3

Ask
View Details
Dinitolmide Impurity 3
RM-D341003-03 50 mg

Dinitolmide Impurity 3

Ask
View Details
Dinitolmide Impurity 3
RM-D341003-04 100 mg

Dinitolmide Impurity 3

Ask
View Details
IGSF6 (m):293T Lysate
sc-126999 100 µg/200 µL

IGSF6 (m):293T Lysate

Ask
View Details