Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers

Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers

Product Specifications

Background

Human alpha synuclein TNG mutant (HuTNG) is a triple mutant containing Ala53 mutated to the equivalent mouse residue Thr53, Ser87 mutated to the equivalent mouse residue Asn87, and Asn103 mutated to the equivalent mouse residue Gly103, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse α-syn (MsWT) is faster than wild-type human α-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse α-syn pathology (1). A53T or S87N substitutions in human α-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuTNG fibrils show enhanced induction of α-syn pathology greater than both HuWT and MsWT fibrils after single unilateral injection into the dorsal striatum in mice (4). Therefore, HuTNG is a good construct for inducing robust endogenous α-syn seeding and pathology in wild-type mice.

Product Name Alternative

Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG

UNSPSC

12352202

Swiss Prot

P37840-1

Host

E. coli

Origin Species

Human

Target

Alpha Synuclein TNG (A53T, S87N, N103G)

Conjugation

No Tag

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Applications

WB, In vivo Assay, In vitro Assay

Purification Method

Ion-exchange Purified

Concentration

2 mg/ml or 5 mg/ml

Purity

>95%

Weight

0.02

Length

Full length (1 - 140 aa)

Buffer

1X PBS pH7.4

Molecular Weight

14.46 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For corresponding PFFs, see catalog# SPR-504

References & Citations

1. Masuda-Suzukake et al. 2013. Prion-like Spreading of Pathological α-synuclein in Brain. Brain. https://doi.org/10.1093/braiwt037 2. Kang, K. et al. 2011. The A53T Mutation is Key in Defining the Differences in the Aggregation Kinetics of Human and Mouse α-synuclein. JACS. https://doi.org/10.1021/ja203979j 3. Ohgita, T. et al. 2023. Intramolecular Interaction Kinetically Regulates Fibril Formation by Human and Mouse Alpha-Synuclein. Sci Rep https://doi.org/10.1038/s41598-023-38070-4 4. Luk, K., C. et al. 2016. Molecular and Biological Compatibility with Host Alpha-Synuclein Influences Fibril Pathogenicity. Cell Rep. https://doi.org/10.1016/j.celrep.2016.08.053

Product MSDS

https://cdn.gentaur.com/products/400/51210132/msds/spr-503c.pdf

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olr1766 AAV siRNA Pooled Vector
34189166 1.0 μg

Olr1766 AAV siRNA Pooled Vector

Ask
View Details
RAS P21 Protein Activator 3 (RASA3) Antibody
abx327832-01 50 µg

RAS P21 Protein Activator 3 (RASA3) Antibody

Ask
View Details
RAS P21 Protein Activator 3 (RASA3) Antibody
abx327832-02 100 µg

RAS P21 Protein Activator 3 (RASA3) Antibody

Ask
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) MURA Polyclonal Antibody
MBS7175808 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) MURA Polyclonal Antibody

Ask
View Details
CBX2, NT (CBX2, Chromobox protein homolog 2) (MaxLight 750)
MBS6281198-01 0.1 mL

CBX2, NT (CBX2, Chromobox protein homolog 2) (MaxLight 750)

Ask
View Details
CBX2, NT (CBX2, Chromobox protein homolog 2) (MaxLight 750)
MBS6281198-02 5x 0.1 mL

CBX2, NT (CBX2, Chromobox protein homolog 2) (MaxLight 750)

Ask
View Details