Tau dGAE (297-391) AD-mimic Pre-formed Fibrils
Human Recombinant Tau dGAE (297-391) AD-mimic Pre-formed Fibrils (fibrilized without heparin)
Product Specifications
Background
Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer’s disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold – i.e. an AD-isolated Tau filaments’ fold is distinct from a CTE-isolated Tau filaments’ fold (1-3).
Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq’s catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).
Product Name Alternative
Tau aggregate, Tau PFFs, Tau PFF, Tau protein aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, dGAE Tau Protein, Tau dGAE
UNSPSC
12352202
Swiss Prot
P10636-8
Host
E. coli
Origin Species
Human
Target
Tau dGAE (AA297-391)
Conjugation
No Tag
Sequence
IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Applications
WB, In vivo Assay, In vitro Assay
Purification Method
Ion-exchange Purified
Concentration
2 mg/ml or 5 mg/ml
Purity
>95%
Weight
0.01
Length
Fragment of full length wild-type Tau 2N4R (297 - 391aa)
Buffer
10mM PB pH 7.4, 10mM DTT, 200mM MgCl2
Molecular Weight
10.165 kDa
Precautions
Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Additionnal Information
For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-501.
References & Citations
1. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annu Rev Neurosci. DOI: https://doi.org/10.1146/annurev-neuro-072116-031153
2. Fitzpatrick et al. 2017. Cryo-EM structures of tau filaments from Alzheimer’s disease. Nature. DOI: 10.1038/nature23002
3. Falcon et al. 2019. Novel tau filament fold in chronic traumatic encephalopathy encloses hydrophobic molecules. Nature. DOI: https://doi.org/10.1038/s41586-019-1026-5.
4. Lovestam et al. 2022. Assembly of Recombinant Tau into Filaments Identical to those of Alzheimer’s disease and Chronic Traumatic Encephalopathy. eLife. DOI: https://doi.org/10.7554/eLife.76494
5. Lovestam et al. 2023. Disease-specific Tau Filaments Assemble via Polymorphic Intermediates. bioRxiv. https://doi.org/10.1101/2023.07.24.550295
Product MSDS
https://cdn.gentaur.com/products/400/51210126/msds/spr-502b.pdf
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items