Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

Human Recombinant Tau dGAE (297-391) AD-mimic Pre-formed Fibrils (fibrilized without heparin)

Product Specifications

Background

Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer’s disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold – i.e. an AD-isolated Tau filaments’ fold is distinct from a CTE-isolated Tau filaments’ fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq’s catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).

Product Name Alternative

Tau aggregate, Tau PFFs, Tau PFF, Tau protein aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, dGAE Tau Protein, Tau dGAE

UNSPSC

12352202

Swiss Prot

P10636-8

Host

E. coli

Origin Species

Human

Target

Tau dGAE (AA297-391)

Conjugation

No Tag

Sequence

IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE

Applications

WB, In vivo Assay, In vitro Assay

Purification Method

Ion-exchange Purified

Concentration

2 mg/ml or 5 mg/ml

Purity

>95%

Weight

0.01

Length

Fragment of full length wild-type Tau 2N4R (297 - 391aa)

Buffer

10mM PB pH 7.4, 10mM DTT, 200mM MgCl2

Molecular Weight

10.165 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Additionnal Information

For best results, sonicate immediately prior to use. Refer to the Neurodegenerative Protein Handling Instructions on our website, or the product datasheet for further information. Monomer source is catalog# SPR-501.

References & Citations

1. Goedert, Eisenberg and Crowther. 2017. Propagation of Tau Aggregates and Neurodegeneration. Annu Rev Neurosci. DOI: https://doi.org/10.1146/annurev-neuro-072116-031153 2. Fitzpatrick et al. 2017. Cryo-EM structures of tau filaments from Alzheimer’s disease. Nature. DOI: 10.1038/nature23002 3. Falcon et al. 2019. Novel tau filament fold in chronic traumatic encephalopathy encloses hydrophobic molecules. Nature. DOI: https://doi.org/10.1038/s41586-019-1026-5. 4. Lovestam et al. 2022. Assembly of Recombinant Tau into Filaments Identical to those of Alzheimer’s disease and Chronic Traumatic Encephalopathy. eLife. DOI: https://doi.org/10.7554/eLife.76494 5. Lovestam et al. 2023. Disease-specific Tau Filaments Assemble via Polymorphic Intermediates. bioRxiv. https://doi.org/10.1101/2023.07.24.550295

Product MSDS

https://cdn.gentaur.com/products/400/51210126/msds/spr-502b.pdf

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

c-Myc (1.N.2)
sc-70469 200 µg/mL

c-Myc (1.N.2)

Ask
View Details
miRNA oligo mix miR-154
MO-0062 100 Reactions

miRNA oligo mix miR-154

Ask
View Details
recombinant human GBM
E4A10X14 100ug

recombinant human GBM

Ask
View Details
Recombinant Human GNB5 Protein, His-SUMO, E.coli-100ug
QP6103-ec-100ug 100ug

Recombinant Human GNB5 Protein, His-SUMO, E.coli-100ug

Ask
View Details
Chicken Lysozyme (LZM) ELISA Kit
EKN52327-01 48 Tests

Chicken Lysozyme (LZM) ELISA Kit

Ask
View Details
Chicken Lysozyme (LZM) ELISA Kit
EKN52327-02 96 Tests

Chicken Lysozyme (LZM) ELISA Kit

Ask
View Details