Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF-D, Human

Vascular Endothelial Growth Factor (VEGF) -D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and pancreas. It binds to VEGFR-2 and VEGFR-3 receptors and activates downstream signals. VEGF-D is a growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth. It is involved in many developmental and physiological processes including the formation of venous and lymphatic vascular systems during embryogenesis and the maintenance of differentiated lymphatic endothelium in adults. In tumor pathology, it has been reported to play a role in restructuring of lymphatic channels and regional lymph node metastasis.

Product Specifications

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

18-19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human VEGF-D remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human VEGF-D should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

CAS Number

9000-83-3

AA Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GIMAP8 Polyclonal Antibody, HRP Conjugated
bs-8274R-HRP 100 µL

GIMAP8 Polyclonal Antibody, HRP Conjugated

Ask
View Details
4933402N22Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10734154 3x1.0μg DNA

4933402N22Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Ask
View Details
Anti-HIV-1 vpr Antibody FITC Conjugated
DZ41711-FITC 200 µL/Vial

Anti-HIV-1 vpr Antibody FITC Conjugated

Ask
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)
PAB647Mu01-01 20 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)
PAB647Mu01-02 100 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)
PAB647Mu01-03 200 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 7 (CCR7)

Ask
View Details