RecombinantVEGF-D, Human
Vascular Endothelial Growth Factor (VEGF) -D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and pancreas. It binds to VEGFR-2 and VEGFR-3 receptors and activates downstream signals. VEGF-D is a growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth. It is involved in many developmental and physiological processes including the formation of venous and lymphatic vascular systems during embryogenesis and the maintenance of differentiated lymphatic endothelium in adults. In tumor pathology, it has been reported to play a role in restructuring of lymphatic channels and regional lymph node metastasis.
Product Specifications
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
18-19 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items