Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Human (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Human IL-5 is homodimeric protein with molecular weight ranging from 29 to 35 kDa due to glycosylation.

Product Specifications

CAS Number

9000-83-3

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 1 ng/ml, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 1x10ˆ6 units/mg.

Reconstitution

Reconstituted in ddH2O or PBS at 100 μg/ml.

Molecular Weight

~29-35 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Host or Source

CHO

Recommended Usage

This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

AA Sequence

IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

R-96544 Hydrochloride
TRC-H942928-25MG 25 mg

R-96544 Hydrochloride

Sign In for Pricing
View Details
Recombinant Mouse Complement C3(C3), partial
AP71181-01 20 µg

Recombinant Mouse Complement C3(C3), partial

Sign In for Pricing
View Details
Recombinant Mouse Complement C3(C3), partial
AP71181-02 100 µg

Recombinant Mouse Complement C3(C3), partial

Sign In for Pricing
View Details
Recombinant Mouse Complement C3(C3), partial
AP71181-03 1 mg

Recombinant Mouse Complement C3(C3), partial

Sign In for Pricing
View Details
MHC class II (Y-Ae) Alexa Fluor® 594
sc-32247 AF594 200 µg/mL

MHC class II (Y-Ae) Alexa Fluor® 594

Sign In for Pricing
View Details
Uaca Mouse shRNA Plasmid (Locus ID 72565)
TL504749 1 Kit

Uaca Mouse shRNA Plasmid (Locus ID 72565)

Sign In for Pricing
View Details