Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (CHO)

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (CHO) is produced in CHO cells, and consists of 153 amino acids (A117-S269) .

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-protein-human-cho.html

Purity

95.00

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 16-23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olr1565 Protein Vector (Rat) (pPM-C-HA)
34042026 500 ng

Olr1565 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
VII Antibody, Biotin conjugated
A50036-50UG 50 µg

VII Antibody, Biotin conjugated

Ask
View Details
Bromophenol Blue sodium salt
GT3694-50g 50 g

Bromophenol Blue sodium salt

Ask
View Details
ZNF133 Antibody, HRP conjugated
CSB-PA026532LB01HU-01 50 µg

ZNF133 Antibody, HRP conjugated

Ask
View Details
ZNF133 Antibody, HRP conjugated
CSB-PA026532LB01HU-02 100 µg

ZNF133 Antibody, HRP conjugated

Ask
View Details
NUDT10 siRNA Oligos set (Human)
32276171 3 x 5 nmol

NUDT10 siRNA Oligos set (Human)

Ask
View Details