Galanin (Human) - FAM Labeled

<strong>Galanin (Human) - FAM Labeled</strong>_x000D_ <strong>Catalog number:</strong> B2019420_x000D_ <strong>Lot number:</strong> Batch Dependent_x000D_ <strong>Expiration Date:</strong> Batch dependent_x000D_ <strong>Amount:</strong> 1 mg_x000D_ <strong>Molecular Weight or Concentration:</strong> 3515.8_x000D_ <strong>Supplied as:</strong> Powder_x000D_ <strong>Applications:</strong> a molecular tool for various biochemical applications_x000D_ <strong>Storage:</strong> -20°C_x000D_ <strong>Keywords:</strong> FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS_x000D_ <strong>Grade:</strong> Biotechnology grade. All products are highly pure. All solutions are made with Type I ultrapure water (resistivity &gt;18 MΩ-cm) and are filtered through 0.22 um._x000D_ _x000D_ <strong>References:</strong>_x000D_ 1: Cui J, Chen Q, Yue X, Jiang X, Gao GF, Yu LC, Zhang Y. Galanin protects against intracellular amyloid toxicity in human primary neurons J Alzheimers Dis. 2010;19(2):529-44._x000D_ 2: Wraith DC, Pope R, Butzkueven H, Holder H, Vanderplank P, Lowrey P, Day MJ, Gundlach AL, Kilpatrick TJ, Scolding N, Wynick D. A role for galanin in human and experimental inflammatory demyelination Proc Natl Acad Sci U S A. 2009 Sep 8;106(36):15466-71._x000D_ 3: Grenbäck E, Bjellerup P, Wallerman E, Lundblad L, Anggård A, Ericson K, Aman K, Landry M, Schmidt WE, Hökfelt T, Hulting AL. Galanin in pituitary adenomas Regul Pept. 2004 Feb 15;117(2):127-39._x000D_ 4: Ortego J, Coca-Prados M. Molecular identification and coexpression of galanin and GalR-1 galanin receptor in the human ocular ciliary epithelium: differential modulation of their expression by the activation of alpha2- and beta2-adrenergic receptors in cultured ciliary epithelial cells J Neurochem. 1998 Dec;71(6):2260-70._x000D_ 5: De Oliveira PA, Moreno E, Casajuana-Martin N, Casadó-Anguera V, Cai NS, Camacho-Hernandez GA, Zhu H, Bonifazi A, Hall MD, Weinshenker D, Newman AH, Logothetis DE, Casadó V, Plant LD, Pardo L, Ferré S. Preferential Gs protein coupling of the galanin Gal(1) receptor in the µ-opioid-Gal(1) receptor heterotetramer Pharmacol Res. 2022 Aug;182:106322._x000D_ 6: Alata W, Yogi A, Brunette E, Delaney CE, van Faassen H, Hussack G, Iqbal U, Kemmerich K, Haqqani AS, Moreno MJ, Stanimirovic DB. Targeting insulin-like growth factor-1 receptor (IGF1R) for brain delivery of biologics FASEB J. 2022 Mar;36(3):e22208._x000D_ 7: Fathi Z, Battaglino PM, Iben LG, Li H, Baker E, Zhang D, McGovern R, Mahle CD, Sutherland GR, Iismaa TP, Dickinson KE, Zimanyi IA. Molecular characterization, pharmacological properties and chromosomal localization of the human GALR2 galanin receptor Brain Res Mol Brain Res. 1998 Jul 15;58(1-2):156-69._x000D_ 8: Pałasz A, Suszka-Świtek A, Kaśkosz A, Plewka D, Bogus K, Filipczyk Ł, Błaszczyk I, Bacopoulou F, Worthington JJ, Piwowarczyk-Nowak A, Tyszkiewicz-Nwafor M, Wiaderkiewicz R. Spexin-expressing neurons in the magnocellular nuclei of the human hypothalamus J Chem Neuroanat. 2021 Jan;111:101883._x000D_ 9: Roberts JL, Hovanes K, Dasouki M, Manzardo AM, Butler MG. Chromosomal microarray analysis of consecutive individuals with autism spectrum disorders or learning disability presenting for genetic services Gene. 2014 Feb 1;535(1):70-8._x000D_ <a href="https://pubmed.ncbi.nlm.nih.gov/9425310">10: Lorimer DD, Matkowskj K, Benya RV. Cloning, chromosomal location, and transcriptional regulation of the human galanin-1 receptor gene (GALN1R) Biochem Biophys Res Commun. 1997 Dec 18;241(2):558-64. </a>_x000D_ _x000D_ <strong>Products Related to Galanin (Human) - FAM Labeled can be found at</strong> <a href="https://moleculardepot.com/product-category/Peptides/"> Peptides</a>