Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sap130, Mouse (His)

Sap130 Protein, a transcriptional repressor, participates in mSin3A corepressor complex assembly or enzymatic activity. It's a component of the complex, including SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Sap130 also interacts with CLEC4E, especially when released by dead or dying cells. Sap130 Protein, Mouse (His) is the recombinant mouse-derived Sap130 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Sap130 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sap130-protein-mouse-his.html

Purity

97

Smiles

PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Molecular Formula

269003 (Gene_ID) Q8BIH0-1 (P845-V1057) (Accession)

Molecular Weight

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to molecular structure of protein.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXO3 (Forkhead Box Protein O3, AF6q21 Protein, Forkhead in Rhabdomyosarcoma-like 1, FKHRL1, FOXO3A) discontinued
150039 100 µg

FOXO3 (Forkhead Box Protein O3, AF6q21 Protein, Forkhead in Rhabdomyosarcoma-like 1, FKHRL1, FOXO3A) discontinued

Ask
View Details
Lentiviral mouse Itih1 shRNA (UAS) - Lentiviral mouse Itih1 shRNA (UAS, iRFP) (100)
GTR15300702 1 Vial

Lentiviral mouse Itih1 shRNA (UAS) - Lentiviral mouse Itih1 shRNA (UAS, iRFP) (100)

Ask
View Details
Lentiviral mouse Cdh24 shRNA (UAS) - Lentiviral mouse Cdh24 shRNA (UAS, RFP) (25)
GTR15192131 1 Vial

Lentiviral mouse Cdh24 shRNA (UAS) - Lentiviral mouse Cdh24 shRNA (UAS, RFP) (25)

Ask
View Details
Human Putative serine protease 41 (PRSS41) ELISA Kit
abx540317 96 Tests

Human Putative serine protease 41 (PRSS41) ELISA Kit

Ask
View Details
Boron Subphthalocyanine Chloride (>90%)
TRC-B675418-1G 1 g

Boron Subphthalocyanine Chloride (>90%)

Ask
View Details
Mouse ALDH5A1 shRNA Plasmid
abx980875-01 150 µg

Mouse ALDH5A1 shRNA Plasmid

Ask
View Details