Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

Product Specifications

Product Name Alternative

(CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60 ERp60) (HACBP) (grp60)

Abbreviation

Recombinant Human CALR protein

Gene Name

CALR

UniProt

P27797

Expression Region

18-417aa

Organism

Homo sapiens (Human)

Target Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Tag

N-terminal 10xHis-tagged and C-terminal Flag-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Tags & Cell Markers

Relevance

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Present in the cortical granules of non-activated oocytes, is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.6 kDa

References & Citations

"HLA-F is a predominantly empty, intracellular, TAP-associated MHC class Ib protein with a restricted expression pattern." Wainwright S.D., Biro P.A., Holmes C.H. J. Immunol. 164:319-328 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934289/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details
Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details
Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-03 0.02 mg (Yeast)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details
Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-04 0.1 mg (Yeast)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details
Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details
Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)
MBS1134898-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Molybdenum cofactor biosynthesis protein C (moaC)

Ask
View Details