Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Daboia palaestinae Disintegrin viperistatin

Product Specifications

Abbreviation

Recombinant Daboia palaestinae Disintegrin viperistatin protein

UniProt

P0C6E2

Expression Region

1-41aa

Organism

Daboia palaestinae (Palestine viper) (Vipera palaestinae)

Target Sequence

CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.2 kDa

References & Citations

"Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933466/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derive
MBS6131888-01 0.1 mL

Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derive

Ask
View Details
Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derive
MBS6131888-02 5x 0.1 mL

Interleukin 8 (IL-8, IL8, C-X-C Motif Chemokine 8, CXCL8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, GCP1, LECT, LUCT, Lymphocyte-derived Neutrophil Activating Factor, LYNAP, Monocyte Derived Neutrophil Activating Peptide, MONAP, Monocyte Derive

Ask
View Details
Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial
MBS1356607-01 0.5 mg (E-Coli)

Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial

Ask
View Details
Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial
MBS1356607-02 0.05 mg (Baculovirus)

Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial

Ask
View Details
Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial
MBS1356607-03 0.5 mg (Yeast)

Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial

Ask
View Details
Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial
MBS1356607-04 0.05 mg (Mammalian-Cell)

Recombinant Human Kin of IRRE-like protein 1 (KIRREL), partial

Ask
View Details