Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Probable protein E5 (E5)

Product Specifications

Abbreviation

Recombinant Human papillomavirus type 16 E5 protein

Gene Name

E5

UniProt

P06927

Expression Region

1-83aa

Organism

Human papillomavirus type 16

Target Sequence

MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT

Tag

N-terminal 10xHis-tagged and C-terminal GST-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Acts to keep host cells in a proliferation-competent state upon differentiation. Enhances host epidermal growth factor receptor (EGFR) activation after stimulation by EGF by inhibiting EGFR internalization. Induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. Since GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 may enhance immune evasion and cell proliferation via a common mechanism. E5 also alters endosomal pH by interacting with the vacuolar H+-ATPase, which is a proton pump responsible for acidifying cellular organelles. Additionally, E5 prevents transport of the major histocompatibility class I to the cell surface and retains the complex in the Golgi apparatus.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.4 kDa

References & Citations

"Endoplasmic reticulum-localized human papillomavirus type 16 E5 protein alters endosomal pH but not trans-Golgi pH." Disbrow G.L., Hanover J.A., Schlegel R. J. Virol. 79:5839-5846 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934280/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit
EKN51158-01 48 Tests

Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit

Ask
View Details
Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit
EKN51158-02 96 Tests

Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit

Ask
View Details
Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit
EKN51158-03 5x 96 Tests

Human Epstein Barr Virus Induced Protein 3 (EBI3) CLIA Kit

Ask
View Details
ZFYVE27 Rabbit Polyclonal Antibody
TA335290 100 µL

ZFYVE27 Rabbit Polyclonal Antibody

Ask
View Details
Mouse Monoclonal TRIM Antibody (488806) [Alexa Fluor 488]
FAB4708G 0.1 mL

Mouse Monoclonal TRIM Antibody (488806) [Alexa Fluor 488]

Ask
View Details
TLR3/NF-kB Leeporter GFP Reporter-HEK293 Cell Line
MBS669679-01 1 Vial

TLR3/NF-kB Leeporter GFP Reporter-HEK293 Cell Line

Ask
View Details