Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P23 Protein

Human Recombinant p23 Protein

Product Specifications

Background

P23 is a small co-chaperone that stabilizes the ATP-bound conformation of HSP90, promoting the maturation of client proteins and preventing premature release. It plays a key role in the late stages of the HSP90 chaperone cycle, ensuring proper folding and functional activation of a wide range of signaling proteins. In neuroscience, p23 is involved in the regulation of neuronal development, synaptic plasticity, and stress responses. Its interaction with HSP90 is critical for maintaining the stability of proteins implicated in neurodegenerative diseases, including tau, glucocorticoid receptors, and kinases. Reduced p23 expression has been associated with increased protein aggregation and cellular stress in models of Alzheimer’s disease. Conversely, enhancing p23 function may improve proteostasis and reduce neurotoxicity. Its role in modulating the chaperone machinery positions p23 as a potential biomarker and therapeutic target in neurodegeneration.

Product Name Alternative

Sid 3177, Co chaperone p23, cPGES, HSP90 co chaperone, cytosolic prostaglandin E2 synthase, PTGES3, TEBP, Prostaglandin E synthase 3

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

10728

Swiss Prot

Q15185

Accession Number

NP_006592.3

Cellular Locus

Cytoplasm

Expression System

E. coli

Host

E. coli

Origin Species

Human

Target

p23

Conjugation

No tag

Nature

Recombinant

Sequence

SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Applications

WB | SDS-PAGE | Functional Assay

Field of Research

Cancer | Heat Shock

Purification Method

Affinity Purified

Purification

Affinity Purified

Limit Of Detection

This product has been certified >90% pure using SDS PAGE analysis. 4uM SPR-303, when added to 2uM SPR-300 (Aha1) -activated HSP90 (2uM; His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C, eliminated all Aha1-mediated ATPase stimulation as well as intrinsic HSP90 ATPase activity. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm) .

Concentration

Lot/batch specific. See included datasheet.

Purity

>90%

Weight

0.1

Buffer

20mM HEPES buffer pH7.2, 80mM NaCl, 10% glycerol

Molecular Weight

~23 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

References & Citations

1. Johnson J.L., Beito T. G., Krco C.J. & Toft D.O. (1994) Mol Cell Biol. 14: 1956-63. 2. Weikl T., Abelmann K. & Buchner J. (1999) J Mol Biol. 293: 685-91. 3. Weaver A.J., Sullivan W.P., Felts S.J., Owen B.A. & Toft, D.O. (2000) J Biol Chem. 275: 23045-52. 4. Nair S.C., et al. (1996) Cell Stress Chaperones. 1: 237-50. 5. Xu Z., et al. (1997) Eur J Biochem. 246, 461-70. 6. Holt S.E., et al. (1999) Genes Dev. 13: 817-26. 7. Hu J., Toft D., Anselmo D. & Wang X. (2002) J Virol. 76: 269-79. 8. Felts S.J. & Toft D.O. (2003) Cell Stress Chaperones. 8: 108-13. 9. Gausdal G., Gjertsen B.T., Fladmark K.E., Demol H., Vandekerckhove J. & Doskeland S.O. (2004) Leukemia.

Shipping Conditions

Blue Ice or 4ºC

Storage Conditions

-20ºC

Background Reference 01

1. Johnson J.L., Beito T. G., Krco C.J. & Toft D.O. (1994) Mol Cell Biol. 14: 1956-63. 2. Weikl T., Abelmann K. & Buchner J. (1999) J Mol Biol. 293: 685-91. 3. Weaver A.J., Sullivan W.P., Felts S.J., Owen B.A. & Toft, D.O. (2000) J Biol Chem. 275: 23045-52. 4. Nair S.C., et al. (1996) Cell Stress Chaperones. 1: 237-50. 5. Xu Z., et al. (1997) Eur J Biochem. 246, 461-70. 6. Holt S.E., et al. (1999) Genes Dev. 13: 817-26. 7. Hu J., Toft D., Anselmo D. & Wang X. (2002) J Virol. 76: 269-79. 8. Felts S.J. & Toft D.O. (2003) Cell Stress Chaperones. 8: 108-13. 9. Gausdal G., Gjertsen B.T., Fladmark K.E., Demol H., Vandekerckhove J. & Doskeland S.O. (2004) Leukemia.

Location

Cytoplasm

AA Sequence

SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Immunogen Species

Human

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella
MBS435419-01 0.05 mL

Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella

Ask
View Details
Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella
MBS435419-02 0.1 mL

Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella

Ask
View Details
Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella
MBS435419-03 5x 0.1 mL

Cytoplasmic protein NCK2 Mouse mAb for Plutella xylostella

Ask
View Details
GTF2E2 (Transcription Initiation Factor IIE Subunit beta, General Transcription Factor IIE, Polypeptide 2, beta 34kD)
482377 100 µL

GTF2E2 (Transcription Initiation Factor IIE Subunit beta, General Transcription Factor IIE, Polypeptide 2, beta 34kD)

Ask
View Details
Recombinant Human Vaccinia Related Kinase 3
32-5237-10 10 µg

Recombinant Human Vaccinia Related Kinase 3

Ask
View Details