IFN-alpha 6/IFNA6, Human (HEK293, His)
IFN-alpha 6 (IFNA6), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 6/IFNA6 Protein, Human (HEK293, His) contains 169 a.a. (S21-E189), produced in HEK293 cells with a C-terminal His-tag.
Product Specifications
Product Name Alternative
IFN-alpha 6/IFNA6 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-alpha-6-protein-human-hek-293-his.html
Purity
95.0
Smiles
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Molecular Formula
3443 (Gene_ID) P05013 (S21-E189) (Accession)
Molecular Weight
Approximately 18 kDa
References & Citations
[1]Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27 (2) :240-52.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266 (17) :11360-5.|[4]Cull VS, et al. Type I interferon gene therapy protects against cytomegalovirus-induced myocarditis. Immunology. 2002 Jul;106 (3) :428-37.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
