Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5F1D), partial

Product Specifications

Product Name Alternative

F-ATPase delta subunit

Abbreviation

Recombinant Human ATP5F1D protein, partial

Gene Name

ATP5F1D

UniProt

P30049

Expression Region

43-161aa

Organism

Homo sapiens (Human)

Target Sequence

ASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Mitochondrial mbrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the mbrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extrambraneous catalytic core, and F0 - containing the mbrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary elent. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core, and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha (3) beta (3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

Molecular Weight

39.4 kDa

References & Citations

Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex.Jordan E.M., Breen G.A.M.Biochim. Biophys. Acta 1130:123-126 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12549598/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NRG3 Protein, Human, Recombinant (His Tag)
PH50767M2-01 100 µg

NRG3 Protein, Human, Recombinant (His Tag)

Ask
View Details
NRG3 Protein, Human, Recombinant (His Tag)
PH50767M2-02 1 mg

NRG3 Protein, Human, Recombinant (His Tag)

Ask
View Details
TOE1 Double Nickase Plasmid (m)
sc-427000-NIC 20 µg

TOE1 Double Nickase Plasmid (m)

Ask
View Details
YAP1 (NM_001130145) Human Tagged ORF Clone Lentiviral Particle
RC225864L4V 200 µL

YAP1 (NM_001130145) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
CYP11B2 Antibody, Biotin conjugated
A18778-50UG 50 µg

CYP11B2 Antibody, Biotin conjugated

Ask
View Details
EIF4G2 (N-Term) Rabbit pAb
MBS8558921-01 0.1 mL

EIF4G2 (N-Term) Rabbit pAb

Ask
View Details