Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PMM1, Human (His)

The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PMM1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pmm1-protein-human-his.html

Smiles

MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

Molecular Formula

5372 (Gene_ID) Q92871 (M1-A262) (Accession)

Molecular Weight

Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal UTP18 Antibody [mFluor Violet 500 SE]
NBP2-97492MFV500 0.1 mL

Rabbit Polyclonal UTP18 Antibody [mFluor Violet 500 SE]

Ask
View Details
Human HSP27 ELISA Kit
OK-0525 1 Kit

Human HSP27 ELISA Kit

Ask
View Details
Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 532]
NBP2-04044AF532 0.1 mL

Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 532]

Ask
View Details
Anti-SARS-CoV-2 (2019-nCoV) Spike Neutralizing Antibody (7D603)
MF-0088615 100 µg

Anti-SARS-CoV-2 (2019-nCoV) Spike Neutralizing Antibody (7D603)

Ask
View Details
Mouse Transcription initiation factor TFIID subunit 5, TAF5 ELISA Kit
MBS9317076-01 48 Well

Mouse Transcription initiation factor TFIID subunit 5, TAF5 ELISA Kit

Ask
View Details
Mouse Transcription initiation factor TFIID subunit 5, TAF5 ELISA Kit
MBS9317076-02 96 Well

Mouse Transcription initiation factor TFIID subunit 5, TAF5 ELISA Kit

Ask
View Details