Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA5B Antibody, FITC conjugated
A67888-50UG 50 µg

SEMA5B Antibody, FITC conjugated

Sign In for Pricing
View Details
Respiratory Syncytial Virus (RSV) Antibody
MBS568353-01 1 mg

Respiratory Syncytial Virus (RSV) Antibody

Sign In for Pricing
View Details
Respiratory Syncytial Virus (RSV) Antibody
MBS568353-02 5x 1 mg

Respiratory Syncytial Virus (RSV) Antibody

Sign In for Pricing
View Details
IDE Antibody, Biotin conjugated
A25779-100UG 100 µg

IDE Antibody, Biotin conjugated

Sign In for Pricing
View Details
IRE1 (ERN1) Human shRNA Lentiviral Particle (Locus ID 2081)
TL320345V 500 µL Each

IRE1 (ERN1) Human shRNA Lentiviral Particle (Locus ID 2081)

Sign In for Pricing
View Details
Lentiviral mouse Plcb3 shRNA (UAS) - Lentiviral mouse Plcb3 shRNA (UAS) plasmid
GTR15209095 1 Vial

Lentiviral mouse Plcb3 shRNA (UAS) - Lentiviral mouse Plcb3 shRNA (UAS) plasmid

Sign In for Pricing
View Details