Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1196 (NM_146464) Mouse Tagged ORF Clone Lentiviral Particle
MR212873L4V 200 µL

Olfr1196 (NM_146464) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2.0 mL V-bottom Amber Tube, with caps
C1026-50 50 PCS

2.0 mL V-bottom Amber Tube, with caps

Sign In for Pricing
View Details
LOC285141 (similar to CG14853-PB) (AP) discontinued
248265-AP 100 µL

LOC285141 (similar to CG14853-PB) (AP) discontinued

Sign In for Pricing
View Details
HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845)
247209 50 µg

HOXB1 (Homeobox B1, HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845)

Sign In for Pricing
View Details
Lentiviral mouse Cd70 shRNA (UAS) - Lentiviral mouseCd70 shRNA (UAS, GFP) (25)
GTR15212084 1 Vial

Lentiviral mouse Cd70 shRNA (UAS) - Lentiviral mouseCd70 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Cobalt Nitrate Hexahydrate
TRC-C100267-1G 1 g

Cobalt Nitrate Hexahydrate

Sign In for Pricing
View Details