VEGF-C, Human (116a.a, HEK293, His)
The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html
Purity
95.0
Smiles
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Molecular Formula
7424 (Gene_ID) P49767 (A112-R227) (Accession)
Molecular Weight
Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
LY6G5C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
BACE1, NT (Beta-secretase 1, Beta-site APP Cleaving Enzyme 1, Beta-site Amyloid Precursor Protein Cleaving Enzyme 1, Aspartyl Protease 2, Asp 2, ASP2, Membrane-associated Aspartic Protease 2, Memapsin-2, BACE1, BACE, KIAA1149) (PE) discontinued
