Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293, His)

The VEGF-C protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293-his.html

Purity

95.0

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 19.4 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB7L1 (Rab-7-like Protein 1, Ras-related Protein Rab-7L1, RAB7L) (MaxLight 550)
MBS6213488-01 0.1 mL

RAB7L1 (Rab-7-like Protein 1, Ras-related Protein Rab-7L1, RAB7L) (MaxLight 550)

Sign In for Pricing
View Details
RAB7L1 (Rab-7-like Protein 1, Ras-related Protein Rab-7L1, RAB7L) (MaxLight 550)
MBS6213488-02 5x 0.1 mL

RAB7L1 (Rab-7-like Protein 1, Ras-related Protein Rab-7L1, RAB7L) (MaxLight 550)

Sign In for Pricing
View Details
Tbx18 Rat Pre-designed siRNA Set A
HY-RS29361 1 Set

Tbx18 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Anti-c-Fms/CSF1R Polyclonal Antibody
PAV5965 100 μL

Rabbit Anti-c-Fms/CSF1R Polyclonal Antibody

Sign In for Pricing
View Details
MTMR14 (NM_022485) Human Over-expression Lysate
LH11722V 100 µg

MTMR14 (NM_022485) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTR1A Antibody, FITC conjugated
MBS7051731-01 0.05 mg

ACTR1A Antibody, FITC conjugated

Sign In for Pricing
View Details