Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mfsd4a (NM_001109069) Rat Tagged ORF Clone
RR213294 10 µg

Mfsd4a (NM_001109069) Rat Tagged ORF Clone

Sign In for Pricing
View Details
GC1qR, ID (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) (MaxLight 650) discontinued
G2023-05A-ML650 100 µL

GC1qR, ID (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)
MBS6170094-01 0.1 mL

TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)

Sign In for Pricing
View Details
TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)
MBS6170094-02 5x 0.1 mL

TREH (Trehalase (brush-border Membrane Glycoprotein), MGC129621, TRE, TREA) (APC)

Sign In for Pricing
View Details
Mouse low density lipoprotein, LDL ELISA Kit
MBS705333-01 24 Well (LIMIT 1)

Mouse low density lipoprotein, LDL ELISA Kit

Sign In for Pricing
View Details
Mouse low density lipoprotein, LDL ELISA Kit
MBS705333-02 48 Well

Mouse low density lipoprotein, LDL ELISA Kit

Sign In for Pricing
View Details