Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CBX4, NT (CBX4, E3 SUMO-protein ligase CBX4, Chromobox protein homolog 4, Polycomb 2 homolog) (MaxLight 750)
MBS6281220-01 0.1 mL

CBX4, NT (CBX4, E3 SUMO-protein ligase CBX4, Chromobox protein homolog 4, Polycomb 2 homolog) (MaxLight 750)

Ask
View Details
CBX4, NT (CBX4, E3 SUMO-protein ligase CBX4, Chromobox protein homolog 4, Polycomb 2 homolog) (MaxLight 750)
MBS6281220-02 5x 0.1 mL

CBX4, NT (CBX4, E3 SUMO-protein ligase CBX4, Chromobox protein homolog 4, Polycomb 2 homolog) (MaxLight 750)

Ask
View Details